DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:265 Identity:74/265 - (27%)
Similarity:109/265 - (41%) Gaps:58/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LPPT------NRIVGGRTADIGSNPWLAYL--HKNSSLVCTGTLITKRFVLTAAHCLHSFHLLTV 90
            |.||      .||..|..|..|..|::..|  ..|.:..|.|::|...:|||||||.:....:|:
  Fly    24 LTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTI 88

  Fly    91 RLGEYDTSTRIDCTSEFCIPTYEEYSVENAYI--HTFFGGRQDSRNDIGLLKLNGTVVYKLFIRP 153
               .|..|.|..       |.|..:......|  |.:..|  :..|||.|::......:.|.   
  Fly    89 ---NYGASIRTQ-------PQYTHWVGSGDIIQHHHYNSG--NLHNDISLIRTPHVDFWSLV--- 138

  Fly   154 ICLFRDPGQVP-YSSTYE--------AAGW-GKIDLINTATVLQTVNLIRLDQSDCERSLRTSLS 208
                 :..::| |:..|:        |:|| |..|.......||:|::..:.||||.|:  .||.
  Fly   139 -----NKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRT--WSLH 196

  Fly   209 YGQFC----AGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYL-CR--GPGVYTYVPS 266
            ....|    .|:   .||.|||||||.....|..:      |:.|:|... |:  .|.|::.|..
  Fly   197 DNMICINTDGGK---STCGGDSGGPLVTHDGNRLV------GVTSFGSAAGCQSGAPAVFSRVTG 252

  Fly   267 FTNWI 271
            :.:||
  Fly   253 YLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 69/252 (27%)
Tryp_SPc 40..274 CDD:238113 70/253 (28%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 70/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436074
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.030

Return to query results.
Submit another query.