DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG11841

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:265 Identity:79/265 - (29%)
Similarity:110/265 - (41%) Gaps:59/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IVGGRTADIGSNPWLAYL-HKNSS----LVCTGTLITKRFVLTAAHCLHSFH--LLTVRLGEYDT 97
            ||.|..|:....|:.|.| |:.::    ..|.||||:.|.|||||||..|.|  :..|||||.:.
  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEF 136

  Fly    98 STRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQ 162
            .|..|....      |::.|.....|..|...| ..||||:::|:..|.:..:..|.||..|.|:
  Fly   137 DTDTDDAEP------EDFGVLALKAHPGFENPQ-LYNDIGIVQLDREVKFNRYKHPACLPFDDGE 194

  Fly   163 VPYSSTYEAAGWGKIDLINTATVLQTVNLIRLDQSDCERSLRTSLS------------------- 208
              ...::.|.|||:               .:..|.:.::.|:..|.                   
  Fly   195 --QHESFIAIGWGQ---------------KKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNG 242

  Fly   209 ---YGQFCAG-QWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRGPGV---YTYVPS 266
               ..|.|.| :...|||:||||||:.....:......| :||.|.| ..|..|.:   ||.|..
  Fly   243 YEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHV-MGITSAG-ITCSTPDIPSAYTRVHY 305

  Fly   267 FTNWI 271
            |.|||
  Fly   306 FLNWI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 77/263 (29%)
Tryp_SPc 40..274 CDD:238113 79/265 (30%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 79/265 (30%)
Tryp_SPc 72..310 CDD:214473 77/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437597
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.