DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and aqrs

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:198 Identity:46/198 - (23%)
Similarity:70/198 - (35%) Gaps:60/198 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSV-------EN 119
            |::|.|.||::|.|:|:.||..              ..|.|...|:   |.:..|:       :|
  Fly    86 SVICAGALISRRMVVTSTHCFQ--------------PRRFDLIYEY---TAKHLSILTGVELDDN 133

  Fly   120 AYIHTFFG------GRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSSTYEAAGWG--- 175
            ...|...|      ..:...|.:.||.|:..:....: |.|.|.|...|.  ....:.|.:|   
  Fly   134 PEPHQVIGFFMPVNKNERFTNYVALLALSNKLDRDKY-RYIPLHRKKPQA--GDDVKMAYYGPPK 195

  Fly   176 -KIDLINTATV----------LQTVNLIRLDQSD--CERSLRTSLSYGQFCAGQWRADTCSGDSG 227
             :|.|.||..:          |:.|..:...:.|  |.|:.|.|           :..|||...|
  Fly   196 FQIRLYNTRVMDIDRCKIHYGLKEVFHVSTFEPDFICVRNKRHS-----------KKTTCSTRPG 249

  Fly   228 GPL 230
            .||
  Fly   250 DPL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 46/198 (23%)
Tryp_SPc 40..274 CDD:238113 46/198 (23%)
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 46/198 (23%)
Tryp_SPc 83..268 CDD:304450 46/198 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.