DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG31219

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:313 Identity:102/313 - (32%)
Similarity:142/313 - (45%) Gaps:67/313 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WIASFAFLVCLTP---KLRAQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLA-YLHKNSSLV- 64
            |:. |...:|..|   :|.:..|   ||.:::   |.|:|||..|.....||:| .|:.|::.: 
  Fly    58 WLL-FGQRICCPPPGNRLPSTEI---CGQSLS---TYRMVGGSEARPNGYPWMAMLLYLNTTTLE 115

  Fly    65 ----CTGTLITKRFVLTAAHCLH----SFHLLTVRLGE----YDTSTRIDC---TSEFCIPTYEE 114
                |.|:||..|:|||:|||::    ...|.:|||||    ||.:...||   .::..:|.. |
  Fly   116 ILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNL-E 179

  Fly   115 YSVENAYIHTFFGGRQDSRN---DIGLLKLNGTVVYKLFIRPICLFRDPGQVP-----YSSTYEA 171
            ..:|...:|..|.. ..:||   ||.||:|...|.|:..|.|||       :|     ..|..|.
  Fly   180 IKLEKIIVHGLFSS-ISNRNIEYDIALLRLKMPVRYRTGIMPIC-------IPKHGFFAKSKLEI 236

  Fly   172 AGWGKIDLINTATVLQ---------TVNLIRLDQSDCERSLRTSLSYGQFCAGQW-RADTCSGDS 226
            |||||.:....:.||.         .|..:|....|..:||       |.|||.: ..|||.|||
  Fly   237 AGWGKTNEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSL-------QICAGGYDGVDTCQGDS 294

  Fly   227 GGPLSRKMSNGRITRTVQLGIVSYGHYLCRG---PGVYTYVPSFTNWILSITR 276
            ||||...|.|..:   ...||.:||...|..   ||:||...:|..||.::.|
  Fly   295 GGPLMVTMDNSSV---YLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVLR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 90/269 (33%)
Tryp_SPc 40..274 CDD:238113 91/271 (34%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 90/269 (33%)
Tryp_SPc 90..342 CDD:238113 91/270 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.