DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG5246

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:247 Identity:68/247 - (27%)
Similarity:110/247 - (44%) Gaps:28/247 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NLPPTNRIVGGRTADIGSNPW-LAYLHKNSSLVCTGTLITKRFVLTAAHCLH-SFHLLTVRLGEY 95
            ::.|..|::||..:..|..|: ::.::.....||.|::|..:::||||||:. ....|.:..|  
  Fly    35 HVKPETRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTG-- 97

  Fly    96 DTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDP 160
                    |.::..|. .||.|:.:.||... .:....|||.|:.....:||....:||.| ...
  Fly    98 --------TVDYTRPG-AEYLVDGSKIHCSH-DKPAYHNDIALIHTAKPIVYDDLTQPIKL-ASK 151

  Fly   161 GQVP-YSSTYEAAGWGKIDLINT-ATVLQTVNLIRLDQSDCERSLRTS--LSYGQFCA-GQWRAD 220
            |.:| ........|||....... :|.||.::|..:|..:|:..:|.:  ||.|..|. .|....
  Fly   152 GSLPKVGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEG 216

  Fly   221 TCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRG-PGVYTYVPSFTNWI 271
            :|.|||||||..       .....:|:|::|.....| |.|:..|..:.:||
  Fly   217 SCHGDSGGPLVD-------ANQTLVGVVNWGEACAIGYPDVFGSVAYYHDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 65/239 (27%)
Tryp_SPc 40..274 CDD:238113 66/240 (28%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 65/239 (27%)
Tryp_SPc 42..263 CDD:238113 66/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437335
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.