DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG31266

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:257 Identity:73/257 - (28%)
Similarity:109/257 - (42%) Gaps:39/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PTNRIVGGRTADIGSNPWLAYLHKNSSL-VCTGTLITKRFVLTAAHC---LHSFHLLTVRLGEYD 96
            |..|::||.||..|:.||:|.:....|. :|...::.:.:|||||.|   |...:||.|      
  Fly    48 PQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVV------ 106

  Fly    97 TSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPG 161
            |.| :|....:.    ..|:|...::|..| .:....|||.||:|:..:.:....:.|.| .|..
  Fly   107 TGT-VDWWDLYA----PYYTVSQIHVHCNF-DKPLYHNDIALLQLSSKIEFNDVTKNITL-ADID 164

  Fly   162 QVPYSSTYEAAGWGKIDLINT-ATVLQTVNLIRLDQSDCERSLRT--SLSYGQFC----AGQWRA 219
            ::........||||..:.:.| ...||..:...|....|...|:.  .:..|..|    |||   
  Fly   165 ELEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQ--- 226

  Fly   220 DTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRG-PGVYTYVPSFTNWILSITRWTQN 280
            ..|.||:||||..:...       .:||.::|....|| |.||.....:.:||    |.|.|
  Fly   227 GACHGDTGGPLIDEQQR-------LVGIGNWGVPCGRGYPDVYARTAFYHDWI----RTTMN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 67/243 (28%)
Tryp_SPc 40..274 CDD:238113 68/245 (28%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 67/243 (28%)
Tryp_SPc 52..275 CDD:238113 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.