DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and modSP

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:323 Identity:80/323 - (24%)
Similarity:118/323 - (36%) Gaps:91/323 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VCLT--------PKLRA----------QFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLH- 58
            ||.|        |::|.          |..:.:|| .:..|......||.|.:....||...|: 
  Fly   325 VCSTGFKTLSPLPEMRCMKGGYWNRGRQRCEQDCG-QLATPIKQFSSGGYTINNTVVPWHVGLYV 388

  Fly    59 ----KNSSLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVEN 119
                |:....|.|:|:|...|:|||||:            ||..||:..       :|:.:.|..
  Fly   389 WHNEKDYHFQCGGSLLTPDLVITAAHCV------------YDEGTRLPY-------SYDTFRVIA 434

  Fly   120 AYIHTFFG------GRQDSR----------------NDIGLLKLNGTVVYKLFIRPICL----FR 158
            |..:..:|      .|:|.|                .|:.||.|:........|||||:    |.
  Fly   435 AKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFA 499

  Fly   159 DPGQVPYSSTYEAAGWGKIDLINTATVLQTVNLIRLDQSDCERSLRTSLSYGQFCA-GQWRADTC 222
            :...|......:.|||.    |.....||.|..:....|.|.|:|| .:...:||. .|.::..|
  Fly   500 EKESVTDDVQGKFAGWN----IENKHELQFVPAVSKSNSVCRRNLR-DIQADKFCIFTQGKSLAC 559

  Fly   223 SGDSGGPLSRKM-----SNGRITRTVQLGIVS-------YGHYLCRGPGVYTYVPSFTNWILS 273
            .|||||..:.::     |.....|....|::|       ..|.|.    |.|.:..|.:.||:
  Fly   560 QGDSGGGFTSELPTNAFSTWNTARHFLFGVISNAPNADQCAHSLT----VMTNIQHFEDMILN 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 69/275 (25%)
Tryp_SPc 40..274 CDD:238113 71/278 (26%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512 6/28 (21%)
Tryp_SPc 371..616 CDD:214473 69/272 (25%)
Tryp_SPc 371..591 CDD:304450 63/243 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437333
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.