DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG3505

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:300 Identity:89/300 - (29%)
Similarity:127/300 - (42%) Gaps:66/300 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DPNCGTTIN----LPPTNRIVGGRT-----ADIG------SN---------PWLA---YLHKNSS 62
            |..||...|    ..|:...:|..|     :|.|      ||         ||||   |...|..
  Fly    68 DNQCGVRGNDVQVCCPSTAGLGALTHPLLPSDCGKVRWQRSNDTDTRIREFPWLALIEYTRGNQE 132

  Fly    63 LV--CTGTLITKRFVLTAAHCL-----HSFHLLTVRLGEYDTSTRIDCTSE------FCIPTYEE 114
            .:  |.|.||:.|:|||||||:     .:..:..|||||:||||..||...      .|.|.|::
  Fly   133 KIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQD 197

  Fly   115 YSVENAYIHTFFGGRQDSR--NDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSS-----TYEAA 172
            .::|....|..: .|.|..  |||.|::|........|::||||   |.:...:.     ..|.|
  Fly   198 IAIEELLPHPLY-NRTDRTQINDIALVRLASPAKLNDFVQPICL---PNKQLRADELEDLVTEVA 258

  Fly   173 GWGKIDLINTATVLQTVNLIRLDQSDCER---SLRTSLSYGQFCAGQWRADTCSGDSGGPLSRKM 234
            ||.............|::.|    .:|:|   |.:..:...:.| |...:..|.|::||||....
  Fly   259 GWQASSSQRMRKGYVTISSI----EECQRKYASQQLRIQASKLC-GLTNSQECYGNAGGPLMLFK 318

  Fly   235 SNGRITRTVQLGIVSYGHYLCRG---PGVYTYVPSFTNWI 271
            ::|.:..    |:||:|...|..   |.|||.|.|:.:||
  Fly   319 NDGYLLG----GLVSFGPVPCPNPDWPDVYTRVASYIDWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 82/280 (29%)
Tryp_SPc 40..274 CDD:238113 83/280 (30%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855 4/13 (31%)
Tryp_SPc 111..356 CDD:238113 77/256 (30%)
Tryp_SPc 111..354 CDD:214473 76/255 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.