DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG31326

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:254 Identity:68/254 - (26%)
Similarity:106/254 - (41%) Gaps:29/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TNRIVGGRTADIGSNPWLAYLHK-----NSSLVCTGTLITKRFVLTAAHCLHS------FHLLTV 90
            |..|..|::...|..|||..:.:     ..:.:|.||||:...||:||||..:      ...|.|
  Fly   271 TPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAV 335

  Fly    91 RLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPIC 155
            .||.  .:..|....||       ..|....||..|..:|.:..|:.|::|:..|.|..:|.|||
  Fly   336 SLGR--NTLAIHSDGEF-------RGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPIC 391

  Fly   156 LFRDPGQ--VPYSSTYEAAGWGKIDLINTAT--VLQTVNLIRLDQSDCERSL-RTSLSYGQFCAG 215
            |:....:  :|.......||||. |...|..  |.:..:|..:.:::|...| ...:.....||.
  Fly   392 LWSTSNRMDLPQGLKSYVAGWGP-DETGTGNTEVSKVTDLNIVSEANCALELPHVLVQPSSLCAK 455

  Fly   216 QWRADTCSGDSGGPLSRKMSNGRITR-TVQLGIVSYGHYLCR--GPGVYTYVPSFTNWI 271
            :..|..|:.|.||||..:..:..:.| .:..|:::.....|.  .|.|:|.|.....|:
  Fly   456 KTGAGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWV 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 66/250 (26%)
Tryp_SPc 40..274 CDD:238113 67/251 (27%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 66/248 (27%)
Tryp_SPc 277..514 CDD:214473 65/246 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436569
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.