DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG9649

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:285 Identity:72/285 - (25%)
Similarity:121/285 - (42%) Gaps:31/285 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TPKLRAQFIDPNCGTTINLPPTNRIV------GGRTADIGSNPWLA----YLHKNSSLVCTGTLI 70
            ||...::|.....|....:....:::      .|...:.|..||:|    ::.::.:.:|.||||
  Fly   227 TPAQASKFYPQTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLI 291

  Fly    71 TKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRND 135
            :.|.|::||||   |...:..|....|...:...|.....:.....|....||..:.....:..|
  Fly   292 SARTVISAAHC---FRFGSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYTDAD 353

  Fly   136 IGLLKLNGTVVYKLFIRPICLFRDPG--QVPYSSTYEAAGWGKIDLINTATVL-QTVNLIRLDQS 197
            :.||:|:..|....:|:||||:.:..  ::|.......||||:.:..|..|.| :..:...:.|.
  Fly   354 LALLQLSNHVDIGDYIKPICLWNENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQW 418

  Fly   198 DCERSLRTS----LSYGQFCAGQWRAD-TCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRG 257
            :|..:|...    ::....||...:|. .|||||||.|..:..:..:.|    |:||.|..:...
  Fly   419 ECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQDIWMLR----GVVSAGQRMTNR 479

  Fly   258 -----PGVYTYVPSFTNWILSITRW 277
                 |.:||.|.....|:|| :.|
  Fly   480 CNLTLPVIYTDVAKHIEWLLS-SMW 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 64/254 (25%)
Tryp_SPc 40..274 CDD:238113 66/256 (26%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 64/247 (26%)
Tryp_SPc 259..497 CDD:214473 64/244 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436602
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.