DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG13318

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:287 Identity:87/287 - (30%)
Similarity:133/287 - (46%) Gaps:47/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SFAFLVCLTPKLRAQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSL-VCTGTLIT 71
            |:..:.|      .|.....||.....||.:.......|..|:.||.|.|...:.: :..|.|||
  Fly   137 SYGLVAC------CQAGSYQCGRRFPPPPGSTTAAPGQASFGAYPWQAALLTTADVYLGGGALIT 195

  Fly    72 KRFVLTAAHCLHSFHL--LTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRN 134
            .:.||||||.:::..|  ..|||||:|.::    ||| .||..:.| :.|.|::..| ...:.:|
  Fly   196 AQHVLTAAHKVYNLGLTYFKVRLGEWDAAS----TSE-PIPAQDVY-ISNVYVNPSF-NPNNLQN 253

  Fly   135 DIGLLKLNGTV--VYKLFIRPICLFRDPGQVPYSSTYE----AAGWGKIDLINTA---TVLQTVN 190
            |:.:|||:..|  ..|..:..:||       |.:|...    .|||||.|...|.   .:.:.|:
  Fly   254 DVAILKLSTPVSLTSKSTVGTVCL-------PTTSFVGQRCWVAGWGKNDFGATGAYQAIERQVD 311

  Fly   191 LIRLDQSDCERSLRTS-------LSYGQF-CA-GQWRADTCSGDSGGPLSRKMSNGRITRTVQLG 246
            :..:..::|:.:|:.:       ||...| || |:...|.|:||.|.||. ..||| :...|  |
  Fly   312 VPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLV-CTSNG-VWYVV--G 372

  Fly   247 IVSYGHYLCRG--PGVYTYVPSFTNWI 271
            :|::|....:.  ||||..|.::..||
  Fly   373 LVAWGIGCAQAGVPGVYVNVGTYLPWI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 78/254 (31%)
Tryp_SPc 40..274 CDD:238113 80/255 (31%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 80/249 (32%)
Tryp_SPc 169..399 CDD:214473 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435540
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.