DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and Prss45

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001008864.1 Gene:Prss45 / 408244 RGDID:1303021 Length:330 Species:Rattus norvegicus


Alignment Length:292 Identity:78/292 - (26%)
Similarity:120/292 - (41%) Gaps:48/292 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WIAS-FAFLVCLTPKLRAQFIDPNCGTTINLPPTNRIVGGRTADIGSN--------PWLAYLHKN 60
            ||.: ||.|:.|.|:       ||.|  .|......:.|   |...|:        ||...|...
  Rat    18 WIPTCFAALLLLPPR-------PNLG--YNEDHAEPVCG---APWWSDSLEERHHWPWEVSLQIE 70

  Fly    61 SSLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTF 125
            :..||.|.||.:.:|::||||:.......|.||   :||.....|.:.:    :..|.:..:|..
  Rat    71 NEHVCGGALIDQSWVVSAAHCIQGNKEYLVMLG---SSTLQPSGSPWAL----KIPVGDIIMHPK 128

  Fly   126 FGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSSTYEAAGWGKIDLINTATVLQTVN 190
            :.|:...|:||.||.|...|.:..:|:||||......:.........|||:.....:|.:.:::.
  Rat   129 YWGQNFIRSDIALLCLETPVTFNKYIQPICLPEHNFNLKVGMKCWVTGWGQAKQHPSAKLTRSLE 193

  Fly   191 LIR-----LDQSDCERSLRTSLSYGQ---------FCAGQWRADTCSGDSGGPLSRKMSNGRITR 241
            |..     :|..:|:|.......|.|         .|....|.:.|.||.||||:.::..    |
  Rat   194 LWEAEVSIVDNKNCDRVFHKKTFYPQVIPLIRKNMICTTNHRENPCYGDPGGPLACEVHG----R 254

  Fly   242 TVQLGIVSYGHYLCRGP--GVYTYVPSFTNWI 271
            .:..||.|:.....:.|  .|||.:..:|.||
  Rat   255 WILAGIFSWEKACTKAPNLSVYTRIDKYTGWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 65/255 (25%)
Tryp_SPc 40..274 CDD:238113 67/256 (26%)
Prss45NP_001008864.1 Tryp_SPc 57..289 CDD:238113 64/241 (27%)
Tryp_SPc 57..286 CDD:214473 62/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.