DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG6865

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:308 Identity:78/308 - (25%)
Similarity:125/308 - (40%) Gaps:74/308 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IASFAFLVCLTPKLRAQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLI 70
            :|..:.:.|    .::|....|...::..|   :||||..|:....|::..|.:.....|.||:|
  Fly     8 VAVLSLVKC----AQSQIAFSNQPCSVRNP---KIVGGSEAERNEMPYMVSLMRRGGHFCGGTII 65

  Fly    71 TKRFVLTAAHC-------------------LHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYS 116
            ::|::|||.||                   |||.......:|....:.|:|..:....|.|:   
  Fly    66 SERWILTAGHCICNGLQQFMKPAQIQGVVGLHSIREYLNGIGNGPDALRVDFKNIVPHPQYD--- 127

  Fly   117 VENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSSTY-EAAGWG----- 175
                        ..|.::||.||:|...:.:...|:|.|:..:.|.......| ..:|||     
  Fly   128 ------------CNDVKHDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHEN 180

  Fly   176 -----KIDLINTATVLQTVNLIRLDQSDCERSLRT-----SLSYGQFCAG--QWRADTCSGDSGG 228
                 :.|::..|||....|      ..||||.|:     ::...|.|||  ..:.|:|..||||
  Fly   181 QAENDRSDVLRKATVKIWNN------EACERSYRSLGKSNTIGETQLCAGYENGQIDSCWADSGG 239

  Fly   229 PLSRKMSNGRITRTVQLGIVSYGHYLCRG--PGVYTYVPSFTNWILSI 274
            ||..|..:       .:|:||.|....|.  ||:||.|..:.:|:..:
  Fly   240 PLMSKEHH-------LVGVVSTGIGCARPGLPGIYTRVSKYVSWMQKV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 72/270 (27%)
Tryp_SPc 40..274 CDD:238113 73/272 (27%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 72/269 (27%)
Tryp_SPc 35..280 CDD:238113 73/272 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.