DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and Jon74E

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:261 Identity:74/261 - (28%)
Similarity:112/261 - (42%) Gaps:57/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RIVGGRTADIGSNPW---LAYLHKNSSLV-CTGTLITKRFVLTAAHCLHSFHLLTVRLG------ 93
            ||.||..|.....|:   |:....|.... |..:||:.|::||||||:.....:|..||      
  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLA 95

  Fly    94 --EYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICL 156
              :...||.                 ...::|..: ..|...|||.|::|....:....||||  
  Fly    96 PRQLIRSTN-----------------PEVHLHPDW-NCQSLENDIALVRLPEDALLCDSIRPI-- 140

  Fly   157 FRDPGQVPYSSTYE-----AAGWGKIDLINTATVLQTVNLIRLDQS--DCERSLRTSLSYGQFC- 213
             |.||.....::|:     |:|||:::..:||.......:.|..:|  |||.|. .::.....| 
  Fly   141 -RLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSY-ANIKPTNICM 203

  Fly   214 ---AGQWRADTCSGDSGGPL--SRKMSNGRITRTVQLGIVSYGHY--LCRG-PGVYTYVPSFTNW 270
               .|:   .||:|||||||  |..:.|..|.    :|:.|||..  ..:| |.|:|.:.::.:|
  Fly   204 DTTGGK---STCTGDSGGPLVYSDPVQNADIL----IGVTSYGKKSGCTKGYPSVFTRITAYLDW 261

  Fly   271 I 271
            |
  Fly   262 I 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 72/259 (28%)
Tryp_SPc 40..274 CDD:238113 73/260 (28%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 72/259 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.