DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG4914

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:252 Identity:91/252 - (36%)
Similarity:125/252 - (49%) Gaps:25/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLHSF--HLLTVRLGEYDTSTR 100
            :|||||.|..:...||:|.|...:...|.||||..|:|||||||:..|  .::.|..||:|.   
  Fly   126 SRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDR--- 187

  Fly   101 IDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFR-DPGQVP 164
              |..:   ...|...|..|:...|.....|  |||.||:||..|....|||||||.| :..|..
  Fly   188 --CNDK---ERPETRFVLRAFSQKFSFSNFD--NDIALLRLNDRVPITSFIRPICLPRVEQRQDL 245

  Fly   165 YSSTYE-AAGWGKI-DLINTATVLQTVNLIRLDQSDC---ERSLRTSLSYGQFCAGQ---WRADT 221
            :..|.. |.|||.: :....:.:||.|.:..||..:|   ....:..::....|:|.   ...|:
  Fly   246 FVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDS 310

  Fly   222 CSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRG--PGVYTYVPSFTNWILSITR 276
            |.|||||||.|...:.:  |..|:||||:|:...|.  |||||.|..:.:||:..:|
  Fly   311 CQGDSGGPLVRLRPDDK--RFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVENSR 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 88/244 (36%)
Tryp_SPc 40..274 CDD:238113 89/246 (36%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 88/244 (36%)
Tryp_SPc 128..363 CDD:238113 89/246 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.