DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG4613

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:261 Identity:90/261 - (34%)
Similarity:126/261 - (48%) Gaps:36/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLHSFHL--LTVRLG 93
            |..:|..||||||........||:|.:.:.:.|.|.||||..|:|||||||:|...:  ::|||.
  Fly   128 TCGVPNVNRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLL 192

  Fly    94 EYD-TSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSR-NDIGLLKLNGTVVYKLFIRPICL 156
            :.| :||.:..|...            |:.|...|....|. :||.||:|:..:.....:||.||
  Fly   193 QLDRSSTHLGVTRSV------------AFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACL 245

  Fly   157 FRDPGQVPYSSTYE---AAGWG-KIDLINTATVLQTVNLIRLDQSDCE-RSLRTSLSYGQFCAGQ 216
               |.....:..::   .|||| ..:..:|::|||.|.:..:..:.|. .|.|:.:.....|||.
  Fly   246 ---PSNWLQNFDFQKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCAGY 307

  Fly   217 WRA---DTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCR---GPGVYTYVPSFTNWILSIT 275
            .:.   |.|.|||||||   :...||.|..  |:||:| |.|.   .|||||.|..:..||...|
  Fly   308 VKTGGRDACQGDSGGPL---IVRDRIFRLA--GVVSFG-YGCAKPDAPGVYTRVSRYLEWIAVNT 366

  Fly   276 R 276
            |
  Fly   367 R 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 83/246 (34%)
Tryp_SPc 40..274 CDD:238113 84/248 (34%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 83/246 (34%)
Tryp_SPc 137..362 CDD:238113 82/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.