DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG10663

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:257 Identity:83/257 - (32%)
Similarity:121/257 - (47%) Gaps:33/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RIVGGRTADIGSNPW-LAYLHKNSSLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGE----YDTS 98
            :|:|||.|..|..|| :|.|::.....|.||||..|:|||||||:..  :|.||:||    |:..
  Fly   506 KIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVRK--VLFVRIGEHNLNYEDG 568

  Fly    99 TRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQ-DSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQ 162
            |.|            :..|..:|.|..|..|. ||  |:.||:|...|....:|...||.:....
  Fly   569 TEI------------QLRVMKSYTHPNFDKRTVDS--DVALLRLPKAVNATTWIGYSCLPQPFQA 619

  Fly   163 VPYSSTYEAAGWGK---IDLINTATVLQTVNLIRLDQSDCERSLRT-SLSYGQFCAGQWRA--DT 221
            :|.:......||||   .|...| :||....:..:...:|.:.... :::...||||..:.  ||
  Fly   620 LPKNVDCTIIGWGKRRNRDATGT-SVLHKATVPIIPMQNCRKVYYDYTITKNMFCAGHQKGHIDT 683

  Fly   222 CSGDSGGP-LSRKMSNGRITRTVQLGIVSYGHYLCRGP--GVYTYVPSFTNWILSITRWTQN 280
            |:|||||| |.|..:......|: .||.|:|....:..  |:|..||::.:|:.|:.....|
  Fly   684 CAGDSGGPLLCRDTTKPNHPWTI-FGITSFGDGCAQRNKFGIYAKVPNYVDWVWSVVNCDGN 744

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 80/246 (33%)
Tryp_SPc 40..274 CDD:238113 81/248 (33%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 80/246 (33%)
Tryp_SPc 507..735 CDD:238113 80/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.