DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG33460

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:287 Identity:83/287 - (28%)
Similarity:120/287 - (41%) Gaps:62/287 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IASFAFLVCLTPKLRAQFIDPNCG-------TTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSL 63
            :||: .||..:..:.|.::...||       |::                  .||.|.||.:.|:
  Fly    10 LASY-MLVIYSDSVSANYLYEQCGLMREEFSTSL------------------GPWTALLHTDGSI 55

  Fly    64 VCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGG 128
            .|.|||||..|:||||.|:.. :.:.|||||:.              .|.....|:..:|.|...
  Fly    56 FCAGTLITDVFILTAASCIRP-NAVKVRLGEFG--------------RYPNELPEDHLVHYFLMY 105

  Fly   129 R----QDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSSTYEAAG--WGKIDLINTATVLQ 187
            |    :...|:||||||...|....:|.|:|:..:| |....||....|  |.:...::....|:
  Fly   106 RLFNNESLANNIGLLKLTKRVQITDYIMPVCIVLNP-QNQQLSTMRFIGNAWMEDSNVSLTKELR 169

  Fly   188 TVNLIRLDQSDCERSLRTSLS-YGQFCAG-QWRADTCSGDSGGPL---SRKMSNGRITRTVQLGI 247
            .: :|:.....|     |:|. |.||||| |....:|.|.:|..|   ||.|:.   .|.:|.||
  Fly   170 PI-VIQSKPKMC-----TNLDLYTQFCAGHQGNLRSCDGLTGSALIQNSRYMNK---YRHIQFGI 225

  Fly   248 VSYGHYLCRGPGVYTYVPSFTNWILSI 274
            .:.....|.....||.|..|..||..:
  Fly   226 ATVNDMDCEESQGYTDVLKFYWWIQDV 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 73/242 (30%)
Tryp_SPc 40..274 CDD:238113 75/244 (31%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 75/232 (32%)
Tryp_SPc 44..249 CDD:214473 73/229 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463291
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.