DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG33465

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:259 Identity:91/259 - (35%)
Similarity:130/259 - (50%) Gaps:14/259 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLHSF 85
            ||.:|..|    :.|.|:..:........:.||:|.::||:..:|.|||:.|.||||||.|:...
  Fly    19 AQLLDKKC----HDPKTSENINFNHGATETAPWMASIYKNNQFICDGTLVHKLFVLTAASCISKD 79

  Fly    86 HLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLF 150
            ..|.|..|.|:...  |.:..|   ..|:|.|..|..|:.| ...:..||||||:|.|.|.:...
  Fly    80 SQLYVLFGMYNQYR--DASQFF---NNEQYGVAVALQHSNF-RPNNGVNDIGLLRLYGEVTHYAH 138

  Fly   151 IRPICLFRD--PGQVPYSSTYEAAGWGKIDLINTATVLQTVNLIRLDQSDCERSLR-TSLSYGQF 212
            |||||:..|  ....|: ..:|..||.:.....::.|.|||.|.:....:|.|:.: ..::.|||
  Fly   139 IRPICIILDHVVKSAPF-ERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLLPINEGQF 202

  Fly   213 CAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRGPGVYTYVPSFTNWILSITR 276
            |||......|..:||.||:...:.|....|||:|:||||..||....|||.|.:|.:||.:..|
  Fly   203 CAGNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPTSVYTDVVAFKDWIYNTVR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 82/234 (35%)
Tryp_SPc 40..274 CDD:238113 84/236 (36%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 84/224 (38%)
Tryp_SPc 46..261 CDD:214473 82/221 (37%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463362
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.