DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG10469

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:267 Identity:72/267 - (26%)
Similarity:112/267 - (41%) Gaps:64/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RIVGGRTADIGSNPW----LAYLH--KNSSLVCTGTLITKRFVLTAAHCLHS---------FHLL 88
            ||:.|..|.....|:    |.|..  |:...:|.||:::.|:::||||||..         .|:.
  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG 87

  Fly    89 TVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAY--IHTFFGGRQDSRNDIGLLKLNGTVVYKLFI 151
            .|:  .:|.               :|..|..:|  :|..| .|:...|||.|:||...:.:..:|
  Fly    88 KVK--SFDD---------------KEIVVNRSYTIVHKKF-DRKTVTNDIALIKLPKKLTFNKYI 134

  Fly   152 RPICLFRDPGQVPYS-STYEA-----AGWGKIDLINTATVLQTVNLIRLDQSDCERSLRTSLS-- 208
            :       |.::|.: .||..     :|||.......:.|||.:....:...:|||.....|.  
  Fly   135 Q-------PAKLPSAKKTYTGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGK 192

  Fly   209 ------YGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSY---GHYLCRGPGVYTYV 264
                  .|..|....:...|.||||||:  .:.:|  :||: :||||:   |....:.|.|.|.|
  Fly   193 SKKVVHNGFICIDSKKGLPCRGDSGGPM--VLDDG--SRTL-VGIVSHGFDGECKLKLPDVSTRV 252

  Fly   265 PSFTNWI 271
            .|:..||
  Fly   253 SSYLKWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 70/265 (26%)
Tryp_SPc 40..274 CDD:238113 71/266 (27%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 70/265 (26%)
Tryp_SPc 24..260 CDD:238113 71/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.