DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG10472

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:293 Identity:86/293 - (29%)
Similarity:134/293 - (45%) Gaps:50/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AFLVCLTPKLRAQFIDPNCGTTINLP-----------PTNRIVGGRTADIGSNPW----LAYLHK 59
            |.::.|...|.||.:|.|....:|:.           |:.||.||:.|:....|:    |.|: .
  Fly     6 ATVLLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYI-T 69

  Fly    60 NSSLVCTGTLITKRFVLTAAHCLHSFHL-LTVRLGEYD-TSTRIDCTSEFCIPTYEEYSVENAYI 122
            ..:..|.||:|:.|:::|||||..|... :.|.||.:| |:.:.:......:.|      :|..:
  Fly    70 GGAAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVET------KNVIV 128

  Fly   123 HTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSSTYE-----AAGWGKI-DLIN 181
            |..:.. :...|||.|:||...:.:..:|:|..|   |.:....|||.     |:||||| |...
  Fly   129 HEDWIA-ETITNDISLIKLPVPIEFNKYIQPAKL---PVKSDSYSTYGGENAIASGWGKISDSAT 189

  Fly   182 TAT-VLQTVNLIRLDQSDCERSLRTSLSYGQFC----AGQWRADTCSGDSGGPLSRKMSNGRITR 241
            .|| :||...:..::.|.|.......::....|    .|   ..||:|||||||  .:.:|..| 
  Fly   190 GATDILQYATVPIMNNSGCSPWYFGLVAASNICIKTTGG---ISTCNGDSGGPL--VLDDGSNT- 248

  Fly   242 TVQLGIVSYGHYL-CR--GPGVYTYVPSFTNWI 271
              .:|..|:|..| |.  .|||:|.:..:.:||
  Fly   249 --LIGATSFGIALGCEVGWPGVFTRITYYLDWI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 75/251 (30%)
Tryp_SPc 40..274 CDD:238113 76/252 (30%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 75/251 (30%)
Tryp_SPc 47..282 CDD:238113 76/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436305
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.