DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:290 Identity:72/290 - (24%)
Similarity:102/290 - (35%) Gaps:67/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWIASFAFLVCLTPKLRAQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLH----KNSSLV 64
            |..::||.:..|...:..:  |...|..||    .||..|..|..|..|::..|.    ......
  Fly     7 LLFSAFALVAALERPVPVK--DMPAGNKIN----GRITNGYPAYEGKVPYIVALRFDNGNGGGWY 65

  Fly    65 CTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGR 129
            |.|::|...:|||||||.:....:|:..|......          |.:..|...|.:        
  Fly    66 CGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQ----------PQFTHYDTGNLH-------- 112

  Fly   130 QDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSSTYE--------AAGWGK-------IDL 179
                |||.|::......:.| :..:.|.|      |...|.        .:|||.       .|.
  Fly   113 ----NDIALIRTPHVDFWSL-VNKVELPR------YDDRYNNFYGWWALLSGWGSSSDSSGMTDY 166

  Fly   180 INTATVLQTVNLIRLDQSDCERSLRTSLSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQ 244
            :|...:..:.|.:.||...........|.|    |......:|||||||||.....|.      |
  Fly   167 LNCVDIQISDNSVCLDYYGSHYITSNHLCY----ATPENKGSCSGDSGGPLVLHDGNR------Q 221

  Fly   245 LGIVSYGH---YLCRGPGVYTYVPSFTNWI 271
            :||||:|.   .|...|...|.|..:.:||
  Fly   222 VGIVSFGSAAGCLSNSPKGLTRVTGYLDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 62/253 (25%)
Tryp_SPc 40..274 CDD:238113 63/254 (25%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 62/253 (25%)
Tryp_SPc 37..254 CDD:238113 63/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435645
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.