DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and yip7

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:273 Identity:73/273 - (26%)
Similarity:114/273 - (41%) Gaps:51/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NCGTTINLPP------------TNRIVGGRTADIGSNPW---LAYLHKNSSLVCTGTLITKRFVL 76
            :.|...|:.|            |.||..|:.|..|..|:   |::.....|..|.|::|...:||
  Fly    15 SAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVL 79

  Fly    77 TAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFC-IPTYEEYSVENAYIHTFFGGRQDSRNDIGLLK 140
            |||||......:|:..|     ..:..:.||. :.:..::....:|:....      ||||.|::
  Fly    80 TAAHCTDGAASVTIYYG-----ATVRTSPEFTQVVSSSKFRQHESYLALTI------RNDISLIQ 133

  Fly   141 LNGTVVYKLFIRPICLFRDPGQVPYSSTYE-----AAGWGKIDLINTATV--LQTVNLIRLDQSD 198
             ..:|.:...:..|.|   |......||||     |:|||......||..  ||.|:|..:..|.
  Fly   134 -TSSVSFSATVNKISL---PAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSK 194

  Fly   199 CERSLRTSLSYGQ-FCAGQW-RADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHY-LCR--GP 258
            |:.:..:.:...: .|.... :|.||.|||||||:   .:|     |.:|..|:|.. .|.  .|
  Fly   195 CQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLA---LDG-----VLIGATSFGSADGCESGAP 251

  Fly   259 GVYTYVPSFTNWI 271
            ..:|.:..:.:||
  Fly   252 AAFTRITYYRDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 67/247 (27%)
Tryp_SPc 40..274 CDD:238113 68/248 (27%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 67/247 (27%)
Tryp_SPc 40..267 CDD:238113 68/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.930

Return to query results.
Submit another query.