DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG15873

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:270 Identity:66/270 - (24%)
Similarity:105/270 - (38%) Gaps:75/270 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PPTNR----IVGGRTADIGSNPWLAYL-HKNSSLVCTGTLITKRFVLTAAHCLHSFHLLTV---- 90
            |.:||    :|..||.:        |: |:..:..|:|.|::.|.||||||||...:..::    
  Fly    42 PKSNRLSRHVVSIRTKN--------YVRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRG 98

  Fly    91 ---------RLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVV 146
                     ||..||.|...........|.||.|                .:||:.:|:|:..|.
  Fly    99 IRVVFGHITRLAVYDESDFRSVDRLVVHPEYERY----------------KKNDLAILRLSERVQ 147

  Fly   147 YKLF-IRPICLFRDPGQVPYSSTYEAAGWGKI--------DLINTATVLQTVNLIRLDQSDCERS 202
            .... :.|: |.|....|.|..|....|||:|        :|:....:|:..:|       |::.
  Fly   148 SSNHDVLPL-LMRKTANVTYGDTCITLGWGQIYQHGPYSNELVYLDVILRPPSL-------CQKH 204

  Fly   203 LRTSLSYGQFC---AGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRGPGVYTYV 264
            ..|..:....|   .|:  :..|:||.||||        :.:....|::. ||..|.|.....::
  Fly   205 YDTFTADHNVCTEPVGE--SMNCAGDMGGPL--------LCKGALFGLIG-GHMGCAGGKAMKFL 258

  Fly   265 P--SFTNWIL 272
            .  .:.:|||
  Fly   259 SFLYYKDWIL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 61/263 (23%)
Tryp_SPc 40..274 CDD:238113 63/261 (24%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 61/250 (24%)
Tryp_SPc 59..250 CDD:238113 55/225 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436734
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.