DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG30414

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:300 Identity:102/300 - (34%)
Similarity:135/300 - (45%) Gaps:46/300 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ASFAFLVC---LTPKLRAQFIDPNCGTTIN--LPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCT 66
            |..|.|||   |........:|.:||||..  :|   .|.||..|.:.||||:..:  ....:|.
  Fly     6 AGLALLVCSIQLGEGAPGHLLDSSCGTTKPEFIP---MITGGADAGLFSNPWMVKV--LGEKLCG 65

  Fly    67 GTLITKRFVLTAAHCLHSFHLLTVRLGEYDT-------------------------STRI---DC 103
            |:|||.|||||||||:.|.| :.||||||.|                         .||.   ||
  Fly    66 GSLITSRFVLTAAHCIVSTH-MRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDC 129

  Fly   104 TSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSST 168
                |:|...|.:|:...:|..:....|  ||||||::...|.|..::|||||..: |.:..|..
  Fly   130 ----CVPKSYELAVDRKILHADYNLNLD--NDIGLLRMKSFVQYSDYVRPICLLVE-GHMAESPI 187

  Fly   169 YEAAGWGKIDLINTATVLQTVNLIRLDQSDCERSLRTSLSYGQFCAGQWRADTCSGDSGGPLSRK 233
            :...|||..:....:..||...:...|...|.......:...|.||....:|.|.||||||||.:
  Fly   188 FNITGWGVTNDGTPSRRLQRATVYNTDLHFCRSKFTKQVDESQICAAGTNSDACHGDSGGPLSAQ 252

  Fly   234 MSNGRITRTVQLGIVSYGHYLCRGPGVYTYVPSFTNWILS 273
            :.......|.|.|:||||...|....|||.|....:||::
  Fly   253 VPFAGSWLTFQYGLVSYGSAACHSFSVYTNVTHHRDWIVN 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 88/259 (34%)
Tryp_SPc 40..274 CDD:238113 90/261 (34%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 88/258 (34%)
Tryp_SPc 41..290 CDD:238113 88/258 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.