DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG9294

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:269 Identity:93/269 - (34%)
Similarity:129/269 - (47%) Gaps:43/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLHSF--HLLTV 90
            ||....|   .:||||:...:...||:|.:...:...|:|:||...:|||||||:...  .|:|:
  Fly    92 CGLINTL---YKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVPPELITL 153

  Fly    91 RLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLF-IRPI 154
            |..|::.|...|   :..|..|    |....:|..:..|... ||:.:|:||..:..:.. :|||
  Fly   154 RFLEHNRSHSND---DIVIQRY----VSRVKVHELYNPRSFD-NDLAVLRLNQPLDMRHHRLRPI 210

  Fly   155 CLFRDPGQVPYSSTYE---AAGWG--KIDLINTATVLQTVNLIRLDQSDCERSLRTSLSYGQ--- 211
            ||   |.| .||..:|   .||||  :.....|.| |:.|:::.|.||:|...  |:...||   
  Fly   211 CL---PVQ-SYSFDHELGIVAGWGAQREGGFGTDT-LREVDVVVLPQSECRNG--TTYRPGQITD 268

  Fly   212 --FCAG---QWRADTCSGDSGGPLSRKMSN--GRITRTVQL-GIVSYGHYLCR--GPGVYTYVPS 266
              .|||   :...|.|||||||||......  |:    .|| ||||:|....|  .|||||.|..
  Fly   269 NMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQ----YQLAGIVSWGVGCARPQSPGVYTRVNQ 329

  Fly   267 FTNWILSIT 275
            :..|:.|.|
  Fly   330 YLRWLGSNT 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 87/252 (35%)
Tryp_SPc 40..274 CDD:238113 88/254 (35%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 87/251 (35%)
Tryp_SPc 101..334 CDD:238113 87/251 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
44.020

Return to query results.
Submit another query.