DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG12133

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:273 Identity:98/273 - (35%)
Similarity:128/273 - (46%) Gaps:37/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CGTTINLPPTNRIVGGRTADIGSNPWL------AYLHK-NSSLVCTGTLITKRFVLTAAHCL--H 83
            ||.:   ||::.||||..|.....||.      ||..| ..|.:|.|:||..|:||||||||  :
  Fly    53 CGQS---PPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVN 114

  Fly    84 SFHLLTVRLGEYDTSTRIDCT-----SEFCIPTYEEYSVENAYIHTFFGGRQDSR-NDIGLLKLN 142
            .|::..|||||:||....|.|     ::...|.:.:..|:....|..:..|.... |||.||:|.
  Fly   115 DFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLK 179

  Fly   143 GTVVYKLFIRPICLFRDPG-QVPYSS----TYEAAGWGKIDLINTATVLQTVNLIRLDQSDCERS 202
            ..|.|.|.|||||::  || ::..||    .::.||||...|...:|||:...:..:...:|...
  Fly   180 SRVKYTLQIRPICIW--PGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNR 242

  Fly   203 LRTSL--SYGQFCAGQW-RADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYG------HYLCRGP 258
            ..|.|  ...|.||..| ..||..||||.||...:..|........||.|||      .|   ||
  Fly   243 YPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGY---GP 304

  Fly   259 GVYTYVPSFTNWI 271
            .|||...|:..||
  Fly   305 AVYTKTSSYYEWI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 92/260 (35%)
Tryp_SPc 40..274 CDD:238113 94/261 (36%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 94/261 (36%)
Tryp_SPc 62..317 CDD:214473 92/259 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463462
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.