DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG1773

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster


Alignment Length:280 Identity:98/280 - (35%)
Similarity:136/280 - (48%) Gaps:44/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QFIDPNCGTTINLPPT----NRIVGGRTADIGSNPWLAYLHKNSSLV---CTGTLITKRFVLTAA 79
            |....:||...||.|.    .||.|||.:.:.|.||:|:||.:..:.   |.|:|:::.||||||
  Fly    40 QLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAA 104

  Fly    80 HCLHSFHL------LTVRLGEYDTSTRIDCTS----EFCIPTYEEYSVENAYIH----TFFGGRQ 130
            ||   |.:      :.|.|||.|.|:..||.:    ..|....||::::...:|    .|:.|  
  Fly   105 HC---FKMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPG-- 164

  Fly   131 DSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYS----STYEAAGWGKIDLINTATVLQTVNL 191
               .||.|:|||..||:|..||||||......:.::    .:|.|.|||:.:....|.....|: 
  Fly   165 ---YDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTESRRFANSTMEVH- 225

  Fly   192 IRLDQSDCERSLRTSLSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCR 256
              ::...|.....||.    .||.....|||:|||||||..|.:.....||||.|:||.|...| 
  Fly   226 --INTEKCTDGRDTSF----LCANGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNC- 283

  Fly   257 GPGVYTY---VPSFTNWILS 273
            |.|...|   ||::..|||:
  Fly   284 GAGQKAYYMDVPTYVPWILA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 89/255 (35%)
Tryp_SPc 40..274 CDD:238113 91/258 (35%)
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 89/255 (35%)
Tryp_SPc 62..301 CDD:238113 88/254 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.820

Return to query results.
Submit another query.