DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG8586

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:300 Identity:85/300 - (28%)
Similarity:120/300 - (40%) Gaps:81/300 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RAQFIDPNCGTTIN----LPPTNRIVGGRTADI-GSNPWLAYLHK-NSSLVCTGTLITKRFVLTA 78
            :|.|...|||.: |    :|..::........| |..||:..:.. ....:|.||||..|.|:|.
  Fly   164 QANFKYKNCGYS-NPKGLIPDNDKFPYSEDVSIFGEFPWMVGIFTGRQEFLCGGTLIHPRLVVTT 227

  Fly    79 AHCL--HSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSR-------- 133
            :|.|  .:...|..|.|::|.:                 |:...|.|      |.||        
  Fly   228 SHNLVNETVDTLVARAGDWDLN-----------------SLNEPYPH------QGSRIKEIIMHS 269

  Fly   134 --------NDIGLLKLNGTVVYKLFIRPICLFRDPGQVP------YSSTYEAAGWG-------KI 177
                    |||.||.|:..:.....|:|:||  .|.:.|      .|.|..|.|||       |:
  Fly   270 EFDPNSLYNDIALLLLDEPIRLAPHIQPLCL--PPPESPELTNQLLSVTCYATGWGTKEAGSDKL 332

  Fly   178 DLINTATVLQTVNLIRLDQSDCERSLRTSLSYGQF-------CA-GQWRADTCSGDSGGPLSRKM 234
            :     .||:.:||..:::.:|:..||.:....:|       || |....|||.||.|.||..:|
  Fly   333 E-----HVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQM 392

  Fly   235 SNGRITRTVQLGIVSYGHYLCRG---PGVYTYVPSFTNWI 271
            . |.:.|...:||||:| ..|..   |.||..||....||
  Fly   393 P-GEMDRYQLVGIVSWG-VECAVEDIPAVYVNVPHLRGWI 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 76/275 (28%)
Tryp_SPc 40..274 CDD:238113 77/275 (28%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 76/265 (29%)
Tryp_SPc 197..430 CDD:214473 75/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.