DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and scaf

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:250 Identity:59/250 - (23%)
Similarity:111/250 - (44%) Gaps:48/250 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AFLVCLTPKLRAQ------------FIDPNCGTTINLPPTNRIVGGRT-----ADIGSN----PW 53
            ||.|.||..|:.:            ::||   ..:||.........||     .|:.:|    ||
  Fly   375 AFRVPLTDCLQTENGSPGKCCRDPNYVDP---WPVNLAGVCATRNKRTKPTGVKDLDANFAEIPW 436

  Fly    54 LAYLHKNSS--LVCTGTLITKRFVLTAAHCLHSFHLLTVRL--GEYDTSTRIDCTSEFCIPTYEE 114
            .|.:.:.||  |:|.|.:|..:|||::|.|::...:..:|:  ||::    :..|:| .:| ::.
  Fly   437 QAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWE----LGSTNE-PLP-FQL 495

  Fly   115 YSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLF-RDPGQVPYSSTYEAAGWGK-- 176
            ..|:...:|..:....:| :|:.:::|...:.:...|:|||:. .||..   |.....:||||  
  Fly   496 TGVKTVDVHPDYDPSTNS-HDLAIIRLERRLEFASHIQPICISDEDPKD---SEQCFTSGWGKQA 556

  Fly   177 IDLINTATVLQTVNLIRLDQSDCERSLRTSLSYGQFCAGQWRADTCSGDSGGPLS 231
            :.:.....::...:.:...:|:|.....:..|..:|       |:|..|.|..|:
  Fly   557 LSIHEEGALMHVTDTLPQARSECSADSSSVCSATKF-------DSCQFDVGSALA 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 49/208 (24%)
Tryp_SPc 40..274 CDD:238113 49/207 (24%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 46/193 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435507
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.