DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG18563

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster


Alignment Length:281 Identity:74/281 - (26%)
Similarity:114/281 - (40%) Gaps:64/281 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NCGTTINLP-PTNRI-VGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAH-CLHSFH-- 86
            |.|.....| ||.|. .|||....|...|:..|......:..|:||:.:.:||||| .::..:  
  Fly   119 NDGAQAEQPKPTERTQPGGRCNTTGLYSWVVALFYEEVYLTGGSLISPKVILTAAHNTMNKMNED 183

  Fly    87 LLTVRLGEYDTSTRIDCTSEFCIP-TYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLF 150
            .:.||.||:..:|    |:|   | .|||..||....|..| ..|...|::.|          :|
  Fly   184 RIVVRAGEFVMNT----TNE---PIQYEERVVERIVRHEGF-IFQSGINNVAL----------IF 230

  Fly   151 IRPICLFRD-------PGQVPYSSTYE-----AAGWGKIDLINT-----ATVLQTVNLIRLDQSD 198
            ::...:..|       |.:   .:::|     .|||   ||:::     ..:::.:.|..||::.
  Fly   231 VKTPFVLNDRIGVLTLPSR---QASFEGRRCTVAGW---DLVSSHDQSRMRIIKKLELTVLDRTT 289

  Fly   199 CERSLRTS-------LSYGQFCA-GQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLC 255
            |....|.:       |.....|| .:...|.|.|..|..|...:.:.......|.|||::|    
  Fly   290 CVAQFRNTTLGRNFDLHPSLICARSEINRDFCFGGGGYALFCSLGDENPHVFEQAGIVAWG---- 350

  Fly   256 RG-----PGVYTYVPSFTNWI 271
            .|     ||:||.|..|.:||
  Fly   351 MGCGLDLPGIYTNVAMFRSWI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 67/266 (25%)
Tryp_SPc 40..274 CDD:238113 68/267 (25%)
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 64/253 (25%)
Tryp_SPc 147..371 CDD:214473 62/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.