DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG4650

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:289 Identity:92/289 - (31%)
Similarity:137/289 - (47%) Gaps:31/289 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSLWIASFAFLVCLTPKLRAQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSL-V 64
            |.|:.|...|.|..|.....:|::|..||...|         |:.|:..|:||:||||.:..| |
  Fly     1 MDSVVIGISALLFLLPVPGSSQYLDGRCGLLTN---------GKIANNISSPWMAYLHTSELLYV 56

  Fly    65 CTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGR 129
            |.||:||::.|||||||..:...|..|:||:..:...:.|      ...||.|...:||:.: ..
  Fly    57 CGGTVITEKLVLTAAHCTRASEQLVARIGEFIGTDDANDT------MLSEYQVSQTFIHSLY-NT 114

  Fly   130 QDSRNDIGLLKLNGTVVYKLFIRPICL--------FRDPGQVPYSSTYEAAGWGKIDLINTATVL 186
            ..|.|||.:|.|...:|:...|||||:        :.|..||     ...|.||..:..|.:...
  Fly   115 TTSANDIAILGLATDIVFSKTIRPICIVWWTIWRKYIDNIQV-----LSGAQWGLPNDRNESDAF 174

  Fly   187 QTVNLIRLDQSDCERSLRTSLSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYG 251
            :..::.|...:.|.....|::...|||||...:..|:.|...||...::...|.|.|.:||.: .
  Fly   175 RITDIRRQPANMCSTLNGTAILSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIAT-T 238

  Fly   252 HYLCRGPGVYTYVPSFTNWILSITRWTQN 280
            :..|:...|||.|.|.|::|||:.|..:|
  Fly   239 NQKCKRASVYTDVLSHTDFILSVWRQYRN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 76/240 (32%)
Tryp_SPc 40..274 CDD:238113 78/242 (32%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 77/246 (31%)
Tryp_SPc 33..258 CDD:304450 77/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463306
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.