DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:262 Identity:90/262 - (34%)
Similarity:122/262 - (46%) Gaps:47/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHC---LHSFHL--LTVRLGE 94
            |...|||||..|.....||:|.|.|:....|.|:|||...:||||||   :.|:.:  ||..||:
  Fly   395 PDQERIVGGINASPHEFPWIAVLFKSGKQFCGGSLITNSHILTAAHCVARMTSWDVAALTAHLGD 459

  Fly    95 YDTST--RIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLF 157
            |:..|  .:...|............|.:.:|          ||:.:|.|:..|.:...|:||||.
  Fly   460 YNIGTDFEVQHVSRRIKRLVRHKGFEFSTLH----------NDVAILTLSEPVPFTREIQPICLP 514

  Fly   158 RDPGQVPYSSTYE-----AAGWGKI-DLINTATVLQTVNLIRLDQSDCERSLRTSLSYGQ----- 211
            ..|.|  .|.:|.     .||||.: :.....::||.|::.....::|.|      .||:     
  Fly   515 TSPSQ--QSRSYSGQVATVAGWGSLRENGPQPSILQKVDIPIWTNAECAR------KYGRAAPGG 571

  Fly   212 -----FCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRG--PGVYTYVPSFTN 269
                 .||||...|:||||||||:... ..||.|   |:||||:|....:|  |||||.|.|...
  Fly   572 IIESMICAGQAAKDSCSGDSGGPMVIN-DGGRYT---QVGIVSWGIGCGKGQYPGVYTRVTSLLP 632

  Fly   270 WI 271
            ||
  Fly   633 WI 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 87/256 (34%)
Tryp_SPc 40..274 CDD:238113 88/257 (34%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 87/256 (34%)
Tryp_SPc 400..637 CDD:238113 88/257 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.