DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG5390

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:256 Identity:78/256 - (30%)
Similarity:118/256 - (46%) Gaps:34/256 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RIVG--GRTADIGSNPW-LAYLHKNSSL---VCTGTLITKRFVLTAAHCLHSFH--LLTVRLGEY 95
            :|.|  .:.|:.|..|| ||.|.:..:|   .|.|.||....|||||||:|:..  .:.||.||:
  Fly   146 KITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEW 210

  Fly    96 DTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDP 160
            ||.|:.:      |..:|:..|:....|..| .:....||:.::.|......:..|:.:||....
  Fly   211 DTQTQTE------IRRHEDRYVKEIIYHEQF-NKGSLYNDVAVMLLESPFTLQENIQTVCLPNVG 268

  Fly   161 GQVPYSSTYEAAGWGKIDLINTA---TVLQTVNLIRLDQSDCERSLRTS------LSYGQF-CA- 214
            .:..:...| |.||||.......   .:|:.|::..:.:..||.:||.:      :.:..| || 
  Fly   269 DKFDFDRCY-ATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAG 332

  Fly   215 GQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRG----PGVYTYVPSFTNWI 271
            |:...|||.||.|.||...:: |:..|....|||::|  :..|    ||||..|.....||
  Fly   333 GEKDKDTCKGDGGSPLVCPIA-GQKNRFKSAGIVAWG--IGCGEVNIPGVYASVAKLRPWI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 76/254 (30%)
Tryp_SPc 40..274 CDD:238113 78/255 (31%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 76/249 (31%)
Tryp_SPc 153..390 CDD:214473 74/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.