DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and Jon25Bii

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster


Alignment Length:271 Identity:64/271 - (23%)
Similarity:100/271 - (36%) Gaps:82/271 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RIVGGRTADIGSNPW---LAYLHKNSSLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTR 100
            ||..|..|..|..|:   |.:...:....|.|::|...:|:|||||.|..|.:|:..|..     
  Fly    42 RITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGAL----- 101

  Fly   101 IDCTSEFCIPTYEEYSVENAYIHTFFGG--RQDS-------RNDIGLLKLNGTVVYKLFIRPICL 156
                          :.::..|.||...|  ||.|       .|||.|:.......:.|.      
  Fly   102 --------------WRLQAQYTHTVGSGHFRQHSDYNTNNLNNDISLINTPHVDFWHLI------ 146

  Fly   157 FRDPGQVPYSSTYE---------AAGWGK-IDLINTATVLQTVNLIRLDQSDC----------ER 201
              :..::|..:...         |:|||: .|....:..|..|:...:.:.:|          :.
  Fly   147 --NKVELPDGNERHDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITRDECSSVYGTDVITDN 209

  Fly   202 SLRTSLSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSY----GHYLCRG--PGV 260
            .:.||...|:        .||:|||||||...      .|:..:|:.|:    |   |..  |..
  Fly   210 VICTSTPGGK--------STCAGDSGGPLVLH------DRSKLVGVTSFVAASG---CTSGLPDG 257

  Fly   261 YTYVPSFTNWI 271
            :|.|.|:.:||
  Fly   258 FTRVTSYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 62/269 (23%)
Tryp_SPc 40..274 CDD:238113 63/270 (23%)
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 62/269 (23%)
Tryp_SPc 43..271 CDD:238113 63/270 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435711
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.930

Return to query results.
Submit another query.