DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG9673

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:270 Identity:71/270 - (26%)
Similarity:114/270 - (42%) Gaps:62/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLHSFHL-------LTVRLG 93
            |..||:||.....|..||.|.:..|.:.||:|.:|:...:||||||:.|..:       |.||||
  Fly    25 PQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLG 89

  Fly    94 EYDTSTRIDCTSEFCIPTYEEY------SVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIR 152
                             |..:|      :|::..||..:|   :..:||.:|:|:.|:|:...|:
  Fly    90 -----------------TINQYAGGSIVNVKSVIIHPSYG---NFLHDIAILELDETLVFSDRIQ 134

  Fly   153 PICLFRDP----------GQVPYSSTYEAAGWGKIDLINTATVLQTVNLIRLDQSDCERSLRTSL 207
            .|.|  .|          .::|..:....||||::.....:...|..|...|.:|.||    ...
  Fly   135 DIAL--PPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANYNTLSRSLCE----WEA 193

  Fly   208 SYGQ---FCAGQWRAD-TCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLC--RGPGVYTYVPS 266
            .||.   .|..:...: .|.||:|..:   :.:.::.|    |:.|:....|  :.|.|.|.|..
  Fly   194 GYGYESVVCLSRAEGEGICRGDAGAAV---IDDDKVLR----GLTSFNFGPCGSKYPDVATRVSY 251

  Fly   267 FTNWILSITR 276
            :..||.:.|:
  Fly   252 YLTWIEANTQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 67/260 (26%)
Tryp_SPc 40..274 CDD:238113 68/262 (26%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 67/260 (26%)
Tryp_SPc 29..259 CDD:238113 68/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.