DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and sphe

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:251 Identity:60/251 - (23%)
Similarity:111/251 - (44%) Gaps:49/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDC 103
            ||:||..||..:..:.|.|..:::.||.|:::::..:||.|||:|       |.|:...::|:.|
  Fly    25 RIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVH-------RDGKLIDASRLAC 82

  Fly   104 TSEFCIPTYEEY------SVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQ 162
            .    :.:..:|      :||:..:|..:   .:..|::.::.|:..:.|...|..|.|......
  Fly    83 R----VGSTNQYAGGKIVNVESVAVHPDY---YNLNNNLAVITLSSELTYTDRITAIPLVASGEA 140

  Fly   163 VP-YSSTYEAAGWGKIDLINTATVLQTVNLIRLDQSDC--------ERSLRTSLSYGQFC-AGQW 217
            :| ..|....||||:......:..::.::|....::.|        |:|         || |.:.
  Fly   141 LPAEGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSDHDEQS---------FCLAHEL 196

  Fly   218 RADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLC--RGPGVYTYVPSFTNWI 271
            :..||.||.||        |.|.....:|:.::....|  |.|.|:..:.|:.:||
  Fly   197 KEGTCHGDGGG--------GAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 58/249 (23%)
Tryp_SPc 40..274 CDD:238113 59/250 (24%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 53/234 (23%)
Tryp_SPc 42..244 CDD:214473 51/232 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436536
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.