DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and spirit

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:307 Identity:93/307 - (30%)
Similarity:131/307 - (42%) Gaps:55/307 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KSLWIASFAFLVCLTPKLRAQFIDPNCGTTIN-LPPTNR----------IVGGRTADIGSNPWLA 55
            |:.:...|...||..|.: |..:..:.....| |...::          :|||........|::|
  Fly    84 KTCYFVRFDHYVCCAPAV-APIVTRSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPREFPFMA 147

  Fly    56 YLHKNSSL------VCTGTLITKRFVLTAAHC--LHSFHLLTVRL-GEYDTSTRIDCTSEFCIPT 111
            .|...|:.      .|.|.||...||||||||  |.......||| |:..|.|..:..|...:..
  Fly   148 ALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLTLTEGEDISIRRVII 212

  Fly   112 YEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSST-YEAAGWG 175
            :.:||...||            |||.||:|.  ...|..::|.|::.   |...::| ..|.|:|
  Fly   213 HPDYSASTAY------------NDIALLELE--TAAKPELKPTCIWT---QKEVTNTLVTAIGYG 260

  Fly   176 KIDL--INTATVLQTVNLIRLDQSDCERSL-RTSLSYG----QFCAGQ--WRADTCSGDSGGPLS 231
            :...  :::|.:|: |.|..:...:|:... :..|:.|    |.|||.  ...|||.||||||| 
  Fly   261 QTSFAGLSSAQLLK-VPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPL- 323

  Fly   232 RKMSNGRITRTVQLGIVSYGHYLCRG-PGVYTYVPSFTNWILSITRW 277
             .|.:|.:...|  ||.|.|.....| |.|||.|.||.:||..|. |
  Fly   324 -LMQDGLLGYVV--GITSLGQGCASGPPSVYTRVSSFVDWIEGIV-W 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 81/261 (31%)
Tryp_SPc 40..274 CDD:238113 83/253 (33%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829 4/13 (31%)
Tryp_SPc 132..364 CDD:238113 83/253 (33%)
Tryp_SPc 132..361 CDD:214473 81/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.