DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG18420

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:281 Identity:101/281 - (35%)
Similarity:146/281 - (51%) Gaps:22/281 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IASFAFLVCLTPKL-RAQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSS-LVCTGT 68
            :||...|:.:.|.| ..||:|..|||...|....|||.|:.|...|:||:|:||.:|: .:|.||
  Fly     8 MASILLLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGT 72

  Fly    69 LITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTY-EEYSVENAYIHTFFGGRQDS 132
            ||::|.|||||||......:.||||||:..          :..| ||:.|...:.|.|:.....:
  Fly    73 LISRRLVLTAAHCFIPNTTIVVRLGEYNRK----------LKGYREEHQVNRTFQHRFYDPNTHA 127

  Fly   133 RNDIGLLKLNGTVVYKLFIRPICLFRDPG---QVPYSSTYEAAGWGKIDLINTATVLQTVNLIRL 194
             |||.||:|...||||..|||||:..|..   .:.........|||:.:.::.::.|:|:::.|.
  Fly   128 -NDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQ 191

  Fly   195 DQSDCERSLRTSLSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRGPG 259
            ....|...   |:...|||||.|.::.|.||:|||:...:......|.||:|| :..:..|:.|.
  Fly   192 PSKMCAFG---SVLSNQFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGI-AITNKRCQRPS 252

  Fly   260 VYTYVPSFTNWILSITRWTQN 280
            |:|.|.|...:|..|. .|||
  Fly   253 VFTDVMSHIEFIRRIF-LTQN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 84/236 (36%)
Tryp_SPc 40..274 CDD:238113 84/238 (35%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 84/236 (36%)
Tryp_SPc 43..267 CDD:238113 84/238 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463303
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.690

Return to query results.
Submit another query.