DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG33458

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:249 Identity:93/249 - (37%)
Similarity:123/249 - (49%) Gaps:9/249 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLHSFHL-LTV 90
            :||.:   ..|.||.|||.:.:..||||||||.||..:|.|:|:...||||||||....:. :.|
  Fly    28 DCGIS---KYTYRITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCFRDKNAKVLV 89

  Fly    91 RLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPIC 155
            ||||.|.|.:|||....|...:.||.:....||..:  |.....||.|.|||..|||...|||||
  Fly    90 RLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLY--RTAHYYDIALAKLNRYVVYTDSIRPIC 152

  Fly   156 LFRDPGQVPYSST---YEAAGWGKIDLINTATVLQTVNLIRLDQSDCERSLRTSLSYGQFCAGQW 217
            |..:|....|..|   :...|||..:....:..||...:.::|:..|.......:.....|||:.
  Fly   153 LMLNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQIDRFTCRYWFGYMVDRTHICAGES 217

  Fly   218 RADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRGPGVYTYVPSFTNWI 271
            :.....|||||||...:......|..|.||||:......|..|:|.:.|::|||
  Fly   218 KHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQPFHGVSVFTNILSYSNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 88/235 (37%)
Tryp_SPc 40..274 CDD:238113 89/236 (38%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 88/235 (37%)
Tryp_SPc 38..274 CDD:238113 89/236 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.