DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG33462

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:281 Identity:97/281 - (34%)
Similarity:149/281 - (53%) Gaps:15/281 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLWIASFAFLVCLTPKLRA--QFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVC 65
            |.:|...|.:.||..:::.  ..::.:||...|:  :.|.|   .|.:..|||:|||.......|
  Fly     2 SNFIIGIAVICCLWRRVQGFQMLLEEDCGIPHNI--SERSV---NAKLAQNPWMAYLETPKGFHC 61

  Fly    66 TGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQ 130
            :||||...||||||||:....|:|||||||:|.|::||.:..|...::||:|:..:.|.::.. .
  Fly    62 SGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNA-N 125

  Fly   131 DSRNDIGLLKLNGTVVYKLFIRPICL-----FRDPGQVPYSSTYEAAGWGKIDLINTATVLQTVN 190
            |..||||:|:|...|.|...|||||:     |::|  :...:.:....|.:.....|:.||:|:|
  Fly   126 DQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEP--IDQLTWFTTTVWRETAANATSKVLRTMN 188

  Fly   191 LIRLDQSDCERSLRTSLSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLC 255
            :.|..:..|......::::.|.|||...:..||.|||.|..|||.:....|.|||||.|.....|
  Fly   189 IDRQPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQC 253

  Fly   256 RGPGVYTYVPSFTNWILSITR 276
            :..|:...:.|:.:||..:.|
  Fly   254 QNSGILMDLLSYADWIKRVVR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 86/236 (36%)
Tryp_SPc 40..274 CDD:238113 87/238 (37%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 84/226 (37%)
Tryp_SPc 48..269 CDD:214473 82/223 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463321
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.690

Return to query results.
Submit another query.