DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and Sp212

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:290 Identity:78/290 - (26%)
Similarity:107/290 - (36%) Gaps:75/290 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RAQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWL-AYLHKN---SSLVCTGTLITKRFVLTAAH 80
            |:|.....||...:..|.  ||.|.....|..||| |..||.   .:..|.|:||:...|::|||
  Fly   259 RSQISSVVCGREGSTTPF--IVRGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAH 321

  Fly    81 CLHSF--HLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYI-----HTFFGGRQDSRNDIGL 138
            |:|..  ..:.|.||.||            :..|.|...|...:     |..:..|..|..||.|
  Fly   322 CVHRMTEDRVVVGLGRYD------------LDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIAL 374

  Fly   139 LKLNGTVVYKLFIRPICLFRDPGQVPYSSTYEAAGWGKIDLINTATVLQTVNLIRLDQSDCE--R 201
            :.:...|.:...|.|||::........|:|...||||:.:                |.|..:  |
  Fly   375 ITIERPVTFNDIIAPICMWTVEASRTVSTTGFIAGWGRDE----------------DSSRTQYPR 423

  Fly   202 SLRTSLSYGQFCAGQWR----------------ADTCSGDSGGPLSRKMSNGRITRTVQLGIVSY 250
            .:...::....||..||                :..|.|||||.|..|..:..:.|    ||||.
  Fly   424 VVEAEIASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLR----GIVSA 484

  Fly   251 GHYLCRGPG---------VYTYVPSFTNWI 271
            |.   |||.         :|..:....|||
  Fly   485 GE---RGPAGTCQLNQYVLYCDLSKHINWI 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 71/269 (26%)
Tryp_SPc 40..274 CDD:238113 73/270 (27%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 73/270 (27%)
Tryp_SPc 277..511 CDD:214473 71/268 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437332
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.