DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and Prss43

DIOPT Version :10

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_955765.1 Gene:Prss43 / 272643 MGIID:2684822 Length:382 Species:Mus musculus


Alignment Length:270 Identity:86/270 - (31%)
Similarity:114/270 - (42%) Gaps:39/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LRAQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLH 83
            |...|....||..|.......:..||     ..||...|...:..||.|:||:.|:|||||||::
Mouse   103 LGGPFFTDTCGHRITEVDPGSLSAGR-----KWPWQVSLQSQNEHVCGGSLISHRWVLTAAHCIY 162

  Fly    84 SFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYK 148
            ......|.||  |.....:..|...:|..:.....|..|.|.       ||||.|..|...|.|.
Mouse   163 EQEEYMVMLG--DDMLHSESESVTLVPVQDIIFPSNFDIQTM-------RNDIALALLYFPVNYS 218

  Fly   149 LFIRPICLFRDPGQVPYSSTYEAAGWG---KIDLINTATVLQTVNLIRLDQSDC----ERSLRTS 206
            ..|:|:||..:|.:|...:.....|||   :||....:.:||.|....|.|..|    :|.|.||
Mouse   219 SLIQPVCLPEEPFRVKNGTVCWVTGWGQQNEIDAGFASILLQEVQQRILLQKHCNTLFQRQLGTS 283

  Fly   207 LSY---GQFC----AGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRGP---GVY 261
            .:.   |..|    :||   ..|.||||.||..:..|   |.| |:||:|:| ..|.|.   .||
Mouse   284 KNLVIKGMICGLQDSGQ---SLCWGDSGNPLVCESDN---TWT-QVGIMSWG-INCNGVPVLSVY 340

  Fly   262 TYVPSFTNWI 271
            |.:..:..|:
Mouse   341 TDIAEYNEWV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 40..274 CDD:238113 81/249 (33%)
Prss43NP_955765.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..97
Tryp_SPc 117..351 CDD:238113 81/256 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.