DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG30323

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:221 Identity:45/221 - (20%)
Similarity:75/221 - (33%) Gaps:77/221 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 HKNSSLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSE------------FCIP 110
            |...:..|.|:|::..:|:|:..|:               |||.:.|..            |...
  Fly    47 HWGDNHFCAGSLLSAWWVVTSGCCV---------------STRPESTPNQPSNRKNLRVVVFTPK 96

  Fly   111 TYEEYSVENAYIHTFFGGRQDSR----NDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSSTY-- 169
            ..::.|.:|.| |.......:|.    .::.||||:..|..:.|...:      .:...:||:  
  Fly    97 RLKKPSPKNIY-HVQKIVLDESAISGCTELALLKLDRGVTGQRFAMML------PEKELNSTWLC 154

  Fly   170 EAAGWGKIDLI-----------------NTATVLQ----TVNLIRLD---------QSDCERSLR 204
            .:.|||:|..:                 |..|..|    :..||::.         :.||.|.|.
  Fly   155 NSLGWGRIYYVSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDCSRCLC 219

  Fly   205 TSLSYGQFCAGQWRADTCSGDSGGPL 230
            .:...|       |.:.|..|.|.||
  Fly   220 MTSYTG-------RGNMCQQDLGSPL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 45/221 (20%)
Tryp_SPc 40..274 CDD:238113 45/221 (20%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 45/221 (20%)
Tryp_SPc 45..272 CDD:214473 45/221 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436701
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.