DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG30289

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:276 Identity:100/276 - (36%)
Similarity:139/276 - (50%) Gaps:17/276 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ASFAFLVCL---TPKLRAQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGT 68
            |..|.||||   ...:.::.:..|||.:.:.|....|.||...:|..|||:..:.  ||..|.|:
  Fly     6 AVIAALVCLFIANNNVMSRLLVENCGISKDDPYVPNIFGGAKTNIQENPWMVLVW--SSKPCGGS 68

  Fly    69 LITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRID----CTSEFCIPTYEEYSVENAYIHTFFGGR 129
            ||.::||||||||: ||..|.||||:|:|   :|    |.:..|||.:...||:...:|..:.| 
  Fly    69 LIARQFVLTAAHCV-SFEDLYVRLGDYET---LDPMPYCLNNHCIPKFYNISVDMKIVHENYNG- 128

  Fly   130 QDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSSTYEAAGWGKIDLINTATVLQTVNLIRL 194
            ...:|||.||:::..|.|..::|||||.... |:.....:...|||:.:....:.:|....|..:
  Fly   129 ITLQNDIALLRMSEAVEYSDYVRPICLLVGE-QMQSIPMFTVTGWGETEYGQFSRILLNATLYNM 192

  Fly   195 DQSDCERSLRTSLSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRG-- 257
            |.|.|...........|.|||...::||.||||||||.|...|....:.|.|:||||...|..  
  Fly   193 DISYCNIKFNKQADRSQICAGSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAANV 257

  Fly   258 PGVYTYVPSFTNWILS 273
            .||||.|.....||.:
  Fly   258 AGVYTNVSYHREWIFN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 88/237 (37%)
Tryp_SPc 40..274 CDD:238113 90/240 (38%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 88/236 (37%)
Tryp_SPc 42..271 CDD:238113 88/236 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.