DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG30288

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:258 Identity:103/258 - (39%)
Similarity:138/258 - (53%) Gaps:14/258 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLHSFH 86
            :.::.:||||.:.....||.|||.|.:.||||:..:..:...||.|:|||.||||||.||:...:
  Fly    25 RLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAVCGGSLITARFVLTAEHCISPMY 89

  Fly    87 LLTVRLGEYDTSTRI-DCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLF 150
             :.||||||||...| ||....|.|......|:...:|:..|      .|||||::..:|::..:
  Fly    90 -MNVRLGEYDTRHPIFDCDDFVCTPRAYNVDVDRKIVHSNPG------YDIGLLRMQRSVIFSNY 147

  Fly   151 IRPICLF--RDPGQVPYS-STYEAAGWGKIDLINTATVLQTVNLIRLDQSDCERSLR-TSLSYGQ 211
            :|||||.  :..|..|.| ..:...|||..........|||..|.:|.|..|||..| ..:||  
  Fly   148 VRPICLILGKTLGGNPLSILRFNFTGWGTNSDGEEQDRLQTATLQQLPQWSCERPGRPLDISY-- 210

  Fly   212 FCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRGPGVYTYVPSFTNWILSI 274
            .|||.:.:|:|.||||||||...:.....|..|.|:.|.|..||.|.|:||.|..||:|||.:
  Fly   211 ICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLCSGLGIYTNVTHFTDWILDV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 96/236 (41%)
Tryp_SPc 40..274 CDD:238113 98/238 (41%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 96/236 (41%)
Tryp_SPc 45..270 CDD:238113 94/233 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.