DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG30187

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:259 Identity:102/259 - (39%)
Similarity:137/259 - (52%) Gaps:20/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLHSFHL 87
            |:|..||..|.|    :|.||..|...::.|:|.:|..:..:|.||||.||||||||||:....:
  Fly    23 FLDQICGINIAL----KITGGHNAAFQNSVWMAAVHNRTHFICGGTLIHKRFVLTAAHCIVDQDV 83

  Fly    88 LTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIR 152
            .:|.||.|:.|...|           ...|..|.:|:.|..|....||||||||:..|::...||
  Fly    84 QSVSLGAYNKSDPAD-----------RKDVITAVVHSSFDVRASYENDIGLLKLSSDVIFNALIR 137

  Fly   153 PICLFRDPGQVPY---SSTYEAAGWGKIDLINTATVLQTVNLIRLDQSDCERSLRTSLSYGQFCA 214
            |||:..:.....:   ..|::|.|||.:....|:.:|||:.|..||:.:|...|....|..|.||
  Fly   138 PICIVLNKSMANHMRNMRTFKAFGWGTLRGNKTSDILQTIILNHLDREECYMELSVYPSEKQICA 202

  Fly   215 GQWRADTCSGDSGGPLSRKM-SNGRITRTVQLGIVSYGHYLCRGPGVYTYVPSFTNWI-LSITR 276
            |....|||.|||||||:..: ..|...|.||.||:|.|...|.|.||||.:.||.:|| ::|.|
  Fly   203 GVPSGDTCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSCDGQGVYTDLMSFADWIKMTIER 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 92/235 (39%)
Tryp_SPc 40..274 CDD:238113 94/238 (39%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 92/235 (39%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.