DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG30091

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:278 Identity:106/278 - (38%)
Similarity:147/278 - (52%) Gaps:20/278 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WIASFAFLVCLTPKLRAQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTL 69
            |:..||::: ...:..|:.:|.:||..:.|.|  :||||..|....|||:|.:..|...:|.|::
  Fly     5 WVVLFAWML-TAGRGSARLLDEDCGVPMQLIP--KIVGGVDAGELKNPWMALIKTNDEFICGGSV 66

  Fly    70 ITKRFVLTAAHCLHS-------FHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFG 127
            ||.:||||||||:.:       :..|||.||.|    .:..|.|...| :|.|:||..|||..| 
  Fly    67 ITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVY----HLLATGEHNHP-HEIYNVERVYIHDSF- 125

  Fly   128 GRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYS---STYEAAGWGKIDLINTATVLQTV 189
            ..|:.||||.||:|..::|||..|:|:|:..:....|.:   ..:.|.|||.......:..||.|
  Fly   126 AIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMV 190

  Fly   190 NLIRLDQSDCERSLRTSLSYGQFCAG-QWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHY 253
            .:.|:|:..||.:...:..|..|||| ....|||..||||||...|....|.|..||||||.|..
  Fly   191 KIYRIDRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTE 255

  Fly   254 LCRGPGVYTYVPSFTNWI 271
            .|||.|:||.|....::|
  Fly   256 DCRGFGMYTDVMGHIDFI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 96/242 (40%)
Tryp_SPc 40..274 CDD:238113 97/243 (40%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 96/242 (40%)
Tryp_SPc 37..276 CDD:238113 97/243 (40%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463345
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.640

Return to query results.
Submit another query.