DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG30088

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:275 Identity:109/275 - (39%)
Similarity:160/275 - (58%) Gaps:10/275 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLWIASFAFLVC------LTPKLRAQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNS 61
            |:.:||.:..:|      |..::.|.|:.|:||.:.......|||.|:.|.:.|.|::|||:.:|
  Fly     2 SISLASTSIYICMCVCLVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSS 66

  Fly    62 SLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFF 126
            .:.|.||:|:.|::||||||:..:  |.|||||:|.:...||....|.|..||:.:..|..:..|
  Fly    67 EIHCGGTIISSRYILTAAHCMRPY--LKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRF 129

  Fly   127 GGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSSTYEAAGWGKIDLINTATVLQTVNL 191
            .  :...|||.||||:..:.:.:.|:||||..:|...|....::|.|||:.:..::|.||||..|
  Fly   130 D--RFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAFGWGQTETNHSANVLQTTVL 192

  Fly   192 IRLDQSDCERSLRTSLSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCR 256
            .|.|...|...|...::..|.|.|...:|||||||||||..|::...:.|.:||||||:|...|:
  Fly   193 TRYDNRHCRSVLSMPITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQ 257

  Fly   257 GPGVYTYVPSFTNWI 271
            .||||||||::..||
  Fly   258 SPGVYTYVPNYIRWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 97/231 (42%)
Tryp_SPc 40..274 CDD:238113 98/232 (42%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 97/231 (42%)
Tryp_SPc 45..273 CDD:238113 98/232 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463253
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.