DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG30087

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:268 Identity:110/268 - (41%)
Similarity:153/268 - (57%) Gaps:6/268 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ASFAFLVCLTPKLR---AQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGT 68
            |.|...:||..:.|   |||::|.||.|.......|:|.|:.|.|.|.|::.|:..||...|.|:
  Fly     6 AWFVIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGS 70

  Fly    69 LITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSR 133
            ::..|::||||||:  |..|.:||||::..|..||....|.|..|||.:..|..|.|:.. .:..
  Fly    71 ILNSRYILTAAHCV--FPNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNA-ANHV 132

  Fly   134 NDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSSTYEAAGWGKIDLINTATVLQTVNLIRLDQSD 198
            |||.|||||.::.:.:.|:|||:..:|...|..:||:..|||:........:|||..|...|.:.
  Fly   133 NDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNGFPHLLQTAELRAYDAAY 197

  Fly   199 CERSLRTSLSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRGPGVYTY 263
            |.||....::..|.|||....|||:|||||||..::....:.|.:||||||||...|:.||||||
  Fly   198 CSRSFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPGVYTY 262

  Fly   264 VPSFTNWI 271
            ||::.|||
  Fly   263 VPNYINWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 96/231 (42%)
Tryp_SPc 40..274 CDD:238113 97/232 (42%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 96/231 (42%)
Tryp_SPc 42..272 CDD:238113 97/232 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463254
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.